Lab Reagents
Amyloid Elisa Laboratories manufactures the amyloid beta peptide elisa reagents distributed by Genprice. The Amyloid Beta Peptide Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact amyloid elisa. Other Amyloid products are available in stock. Specificity: Amyloid Category: Beta Group: Peptide Elisa
Peptide Elisa information
beta Amyloid (7-22) Peptide |
20-abx266505 |
Abbexa |
-
EUR 710.40
-
EUR 1228.80
-
EUR 510.00
|
|
|
Amyloid beta A4 Blocking Peptide |
AF6084-BP |
Affbiotech |
1mg |
EUR 234 |
Amyloid Beta-peptide (25-35) (human) |
A1039-1 |
ApexBio |
1 mg |
EUR 138 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-10 |
ApexBio |
10 mg |
EUR 448.8 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-25 |
ApexBio |
25 mg |
EUR 606 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-5 |
ApexBio |
5 mg |
EUR 292.8 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-Peptide (12-28) (human) |
A1123-1 |
ApexBio |
1 mg |
EUR 157.2 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-10 |
ApexBio |
10 mg |
EUR 547.2 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-25 |
ApexBio |
25 mg |
EUR 741.6 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-5 |
ApexBio |
5 mg |
EUR 351.6 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-10 |
ApexBio |
10 mg |
EUR 895.2 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-25 |
ApexBio |
25 mg |
EUR 1228.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-5 |
ApexBio |
5 mg |
EUR 560.4 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
beta-Amyloid Peptide (1-42), rat |
5-00460 |
CHI Scientific |
4 x 1mg |
Ask for price |
Parallel topology beta – Amyloid modified peptide |
5-01729 |
CHI Scientific |
4 x 1mg |
Ask for price |