Ribonucleic acid

ExpressArt LBR RNAready for Solid tissues & Bacteria

fallback-image

Amyloid Beta Peptide Elisa

Lab Reagents

Amyloid Elisa Laboratories manufactures the amyloid beta peptide elisa reagents distributed by Genprice. The Amyloid Beta Peptide Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact amyloid elisa. Other Amyloid products are available in stock. Specificity: Amyloid Category: Beta Group: Peptide Elisa

Peptide Elisa information

beta Amyloid (7-22) Peptide

20-abx266505
  • EUR 710.40
  • EUR 1228.80
  • EUR 510.00
  • 10 mg
  • 25 mg
  • 5 mg

Amyloid beta A4 Blocking Peptide

AF6084-BP 1mg
EUR 234

Amyloid beta-peptide(25-35)

HY-P0128 10mg
EUR 687.6

Amyloid Beta-peptide (25-35) (human)

A1039-1 1 mg
EUR 138
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-10 10 mg
EUR 448.8
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-25 25 mg
EUR 606
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-5 5 mg
EUR 292.8
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-Peptide (12-28) (human)

A1123-1 1 mg
EUR 157.2
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-10 10 mg
EUR 547.2
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-25 25 mg
EUR 741.6
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-5 5 mg
EUR 351.6
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-10 10 mg
EUR 895.2
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-25 25 mg
EUR 1228.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-5 5 mg
EUR 560.4
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

beta-Amyloid Peptide (1-42), rat

5-00460 4 x 1mg Ask for price

Parallel topology beta – Amyloid modified peptide

5-01729 4 x 1mg Ask for price

Recent Posts

Tags

September 2022
M T W T F S S
 1234
567891011
12131415161718
19202122232425
2627282930  

Categories