Lab Reagents

Amyloid Elisa Laboratories manufactures the amyloid beta peptide elisa reagents distributed by Genprice. The Amyloid Beta Peptide Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact amyloid elisa. Other Amyloid products are available in stock. Specificity: Amyloid Category: Beta Group: Peptide Elisa

Peptide Elisa information

beta Amyloid (12-20) Peptide
20-abx266143	Abbexa	EUR 411.00 EUR 662.00 EUR 314.00	10 mg 25 mg 5 mg

beta Amyloid (pT743) Blocking Peptide
20-abx062025	Abbexa	EUR 314.00 EUR 509.00	1 mg 5 mg

Amyloid beta-peptide(25-35)
HY-P0128	MedChemExpress	10mg	EUR 573

beta-Amyloid Peptide (1-42), rat
5-00460	CHI Scientific	4 x 1mg	Ask for price

Parallel topology beta – Amyloid modified peptide
5-01729	CHI Scientific	4 x 1mg	Ask for price

[Ile34] beta Amyloid (25 34) Peptide
20-abx266164	Abbexa	EUR 439.00 EUR 718.00 EUR 328.00	10 mg 25 mg 5 mg

[Gln11] beta Amyloid (1-16) Peptide
20-abx266503	Abbexa	EUR 592.00 EUR 1024.00 EUR 425.00	10 mg 25 mg 5 mg

Anti-Amyloid beta peptide (mouse) antibody
STJ72677	St John's Laboratory	100 µg	EUR 359

Amyloid Beta-peptide (25-35) (human)
A1039-1	ApexBio	1 mg	EUR 115
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)
A1039-10	ApexBio	10 mg	EUR 374
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)
A1039-25	ApexBio	25 mg	EUR 505
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)
A1039-5	ApexBio	5 mg	EUR 244
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-Peptide (12-28) (human)
A1123-1	ApexBio	1 mg	EUR 131
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)
A1123-10	ApexBio	10 mg	EUR 456
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)
A1123-25	ApexBio	25 mg	EUR 618
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)
A1123-5	ApexBio	5 mg	EUR 293
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.