Ribonucleic acid

ExpressArt LBR RNAready for Solid tissues & Bacteria

fallback-image

Amyloid Beta Peptide Elisa

Lab Reagents

Amyloid Elisa Laboratories manufactures the amyloid beta peptide elisa reagents distributed by Genprice. The Amyloid Beta Peptide Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact amyloid elisa. Other Amyloid products are available in stock. Specificity: Amyloid Category: Beta Group: Peptide Elisa

Peptide Elisa information

beta Amyloid (12-20) Peptide

20-abx266143
  • EUR 411.00
  • EUR 662.00
  • EUR 314.00
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (pT743) Blocking Peptide

20-abx062025
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg

Amyloid beta-peptide(25-35)

HY-P0128 10mg
EUR 573

beta-Amyloid Peptide (1-42), rat

5-00460 4 x 1mg Ask for price

Parallel topology beta – Amyloid modified peptide

5-01729 4 x 1mg Ask for price

[Ile34] beta Amyloid (25 34) Peptide

20-abx266164
  • EUR 439.00
  • EUR 718.00
  • EUR 328.00
  • 10 mg
  • 25 mg
  • 5 mg

[Gln11] beta Amyloid (1-16) Peptide

20-abx266503
  • EUR 592.00
  • EUR 1024.00
  • EUR 425.00
  • 10 mg
  • 25 mg
  • 5 mg

Anti-Amyloid beta peptide (mouse) antibody

STJ72677 100 µg
EUR 359

Amyloid Beta-peptide (25-35) (human)

A1039-1 1 mg
EUR 115
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-10 10 mg
EUR 374
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-25 25 mg
EUR 505
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-peptide (25-35) (human)

A1039-5 5 mg
EUR 244
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-Peptide (12-28) (human)

A1123-1 1 mg
EUR 131
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-10 10 mg
EUR 456
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-25 25 mg
EUR 618
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (12-28) (human)

A1123-5 5 mg
EUR 293
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Recent Posts

Tags

May 2022
M T W T F S S
 1
2345678
9101112131415
16171819202122
23242526272829
3031  

Categories