Lab Reagents
Amyloid Elisa Laboratories manufactures the amyloid beta peptide elisa reagents distributed by Genprice. The Amyloid Beta Peptide Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact amyloid elisa. Other Amyloid products are available in stock. Specificity: Amyloid Category: Beta Group: Peptide Elisa
Peptide Elisa information
beta Amyloid (12-20) Peptide |
20-abx266143 |
Abbexa |
-
EUR 411.00
-
EUR 662.00
-
EUR 314.00
|
|
|
beta Amyloid (pT743) Blocking Peptide |
20-abx062025 |
Abbexa |
|
|
|
beta-Amyloid Peptide (1-42), rat |
5-00460 |
CHI Scientific |
4 x 1mg |
Ask for price |
Parallel topology beta – Amyloid modified peptide |
5-01729 |
CHI Scientific |
4 x 1mg |
Ask for price |
[Ile34] beta Amyloid (25 34) Peptide |
20-abx266164 |
Abbexa |
-
EUR 439.00
-
EUR 718.00
-
EUR 328.00
|
|
|
[Gln11] beta Amyloid (1-16) Peptide |
20-abx266503 |
Abbexa |
-
EUR 592.00
-
EUR 1024.00
-
EUR 425.00
|
|
|
Amyloid Beta-peptide (25-35) (human) |
A1039-1 |
ApexBio |
1 mg |
EUR 115 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-10 |
ApexBio |
10 mg |
EUR 374 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-25 |
ApexBio |
25 mg |
EUR 505 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-peptide (25-35) (human) |
A1039-5 |
ApexBio |
5 mg |
EUR 244 |
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42). |
Amyloid Beta-Peptide (12-28) (human) |
A1123-1 |
ApexBio |
1 mg |
EUR 131 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-10 |
ApexBio |
10 mg |
EUR 456 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-25 |
ApexBio |
25 mg |
EUR 618 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (12-28) (human) |
A1123-5 |
ApexBio |
5 mg |
EUR 293 |
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |